DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or59c

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:406 Identity:80/406 - (19%)
Similarity:138/406 - (33%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSP-------VDAMDAFCPLACSFTTLFKL----- 89
            |::.||.:...              |..:...|       |...|.|.|  ..|.|..::     
  Fly    46 WIYSLWTLTTM--------------WLGIVYLPLGLSLTYVKHFDRFTP--TEFLTSLQVDINCI 94

  Fly    90 ----------GWMWWRRQEVADLMDRIRLLIGEQEKR--EDSRRKVAQRSYYLMVTRCGMLV--- 139
                      ..||..|        |:..||...:||  ..::|::    ::.||.|..::|   
  Fly    95 GNVIKSCVTYSQMWRFR--------RMNELISSLDKRCVTTTQRRI----FHKMVARVNLIVILF 147

  Fly   140 ------FTLGSITTGAFVLRSLWEM------WVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLY 192
                  |...::.|..|..::.|::      |.:.|                            :
  Fly   148 LSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGH----------------------------W 184

  Fly   193 STWSGQVTVYAFA--GTDGFFFGFTLYMAFL------LQALRYDIQDALKPIR-DPSLRESKICC 248
            ..|...:..|...  ||.......|..:.|:      |..||    |.:..:| ||.|.|.:...
  Fly   185 QLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILR----DRIANLRQDPKLSEMEHYE 245

  Fly   249 QRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSG--YNIIRYVVYTFT 311
            |.:|.|.| |..|.:..:....|::...|..|:...:.:..:.|.||.:..  :.|:..|.:...
  Fly   246 QMVACIQD-HRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVA 309

  Fly   312 VSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSL 375
            :.:..|..|.....:..:|:.:..|.:.|.|.|.||..:..|...:.|||:||.... ..|..|:
  Fly   310 ICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISV 374

  Fly   376 PVFTSVIKFTGSIVAL 391
            ....:|.||..:|:.:
  Fly   375 QSNIAVAKFAFTIITI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 75/368 (20%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 71/352 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.