DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or49a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:386 Identity:82/386 - (21%)
Similarity:150/386 - (38%) Gaps:54/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNYPLAKHLFFVTRYSFGLLGL-RFGKEQSWLHLLWLVFNFV--NLAHCCQAEFV----FGWSHL 65
            |:|   :...|:....|..||. .|...:.|...|.:...||  .:::..:|..|    ..|..|
  Fly     5 RSY---EDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESL 66

  Fly    66 RTSPVDAMDAFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYL 130
            ..||...|..........::..|.......|:.:..|..|::.|   ...:|.::||.....|||
  Fly    67 AGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKEL---YPHKEQNQRKYEVNKYYL 128

  Fly   131 MV-TRCGMLVFTLGSITTGAFVLRSLWEMWV----RRHQEFKFDMPFRMLFHDFAHRMPWFPVFY 190
            .. ||..:.|:....:......|.....|::    :....:|...|.|:.| |....:.:...:.
  Fly   129 SCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTF-DSEKPLGYVLAYV 192

  Fly   191 LYSTWSGQVTVYAFAGTD----------GFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESK 245
            :..|:| |..|....|||          ....|   |:|.:|.::|            ||....:
  Fly   193 IDFTYS-QFIVNVSLGTDLWMMCVSSQISMHLG---YLANMLASIR------------PSPETEQ 241

  Fly   246 ICCQRLADIVDRHN---EIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNI--IRY 305
            ..|..||.|:.||.   .::|.|....|::.|...  |.::.|:...:...::  .|:|.  |.|
  Fly   242 QDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNL--FTTSCLLCCMAYYTVV--EGFNWEGISY 302

  Fly   306 VVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITV 366
            ::...:|::..::....|..:...|.:|.:||:.|.||......::.:.:::.:||||:.:
  Fly   303 MMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/319 (21%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/300 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.