DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or47b

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:405 Identity:89/405 - (21%)
Similarity:163/405 - (40%) Gaps:64/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FFVTRYSFGLLGLRFGKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPV--------DAM 73
            |:..|....||.....|:.:.|.|    :.::||...|....:| |:.....|.        |.:
  Fly    37 FYYVRAFLSLLCQYPNKKLASLPL----YRWINLFIMCNVMTIF-WTMFVALPESKNVIEMGDDL 96

  Fly    74 DAFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKRE------DSRRKVAQRSYYLMV 132
            .....:|..||.:|   :|..|..|:.:|:...     |...||      |......||..|::.
  Fly    97 VWISGMALVFTKIF---YMHLRCDEIDELISDF-----EYYNRELRPHNIDEEVLGWQRLCYVIE 153

  Fly   133 TRCGMLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMP------WFPVFYL 191
            :...:..|.|.:..:.|..|:.|.       .|.|  :||..::....||:.      ||  .|:
  Fly   154 SGLYINCFCLVNFFSAAIFLQPLL-------GEGK--LPFHSVYPFQWHRLDLHPYTFWF--LYI 207

  Fly   192 YSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADIVD 256
            :.:.:.|..:.:....|.......|..|..|:.|..:|    :.:.|..:.:.:. .:....:|.
  Fly   208 WQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEI----RKLGDMEVSDKRF-HEEFCRVVR 267

  Fly   257 RHNEIEKIV----KEFSGIMAAPTFVHF----VSASLVIATSVIDILLYSGYNIIRYVVYTFTVS 313
            .|..|.|:|    :.|:|...|.....|    :|....:|.:.:|..:.:.:.::..|.:.    
  Fly   268 FHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFI---- 328

  Fly   314 SAIFLYCYGGTEMSTESLSLGEAAYS-SAWYTWDRETRRRVFLIILRAQRPIT-VRVPFFAPSLP 376
             .:.|:|..||.:.|:|:.:.:||:. :.|:|.....:|.:..:|||||:|:. |..||...:|.
  Fly   329 -QLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLG 392

  Fly   377 VFTSVIKFTGSIVAL 391
            .:..|:|....::||
  Fly   393 TYMLVLKNCYRLLAL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 75/347 (22%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 74/342 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.