DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or47a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:404 Identity:84/404 - (20%)
Similarity:165/404 - (40%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTRYSFGLLGLRFGKE--QSWL--HLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMDAFCPL 79
            |.:.:..|||.....|  :.|.  :....||:...:.....|..:..|.::    :...||...|
  Fly     7 VQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNV----LLLADAMVAL 67

  Fly    80 ACSFTTLFKLGWMWWRRQEVADLMDRIRLLI-GEQEKRED------SRRKVAQRSYYLMVTRCGM 137
            ..:...|||...:.:.|::...|:|:.|||: .|.|:.|:      :..|..||...|..| |.:
  Fly    68 LITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRT-CFL 131

  Fly   138 LVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPW-------FPVFYLYSTW 195
            |.:.|.|:..   ::|.....|:..|.|  .::||..||       ||       :.:.:::|.:
  Fly   132 LAWALNSVLP---LVRMGLSYWLAGHAE--PELPFPCLF-------PWNIHIIRNYVLSFIWSAF 184

  Fly   196 SGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADI----VD 256
            :....|......|..|..||..:....:..:|.:    ...:..||:||:....::..:    :|
  Fly   185 ASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKV----VRFKGGSLKESQATLNKVFALYQTSLD 245

  Fly   257 RHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCY 321
            ..|::.:.   :..|:.|.   .|:|:..:.....:..:.::....:.|..:..|:....::|||
  Fly   246 MCNDLNQC---YQPIICAQ---FFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAYIYCY 304

  Fly   322 GGTEMSTESLSLGEAAYSSAWYT------WDRETRRRVFLIILRAQRPITVRVPFFAPSLPVFTS 380
            .|..:.|||.|...|.|.|.|:.      ......|.:.:.::||.|...:...||..::..|:|
  Fly   305 CGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGYFFEANMEAFSS 369

  Fly   381 VIKFTGSIVALAKT 394
            :::...|.:.:.::
  Fly   370 IVRTAMSYITMLRS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 73/341 (21%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 73/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.