DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or35a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:243 Identity:47/243 - (19%)
Similarity:86/243 - (35%) Gaps:62/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DMPFRMLFHDFAHRMPWFPVFYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLL-------QALR 226
            |..:.|:|...:..:..|....|.:.|.|.|       .|...||.|..:..|:       ..|:
  Fly   165 DFLYSMIFPFDSDPLYIFVPLLLTNVWVGIV-------IDTMMFGETNLLCELIVHLNGSYMLLK 222

  Fly   227 YDIQDALKPI-----RDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFV-SASL 285
            .|:|.|::.|     |....::.|:.   :...:.::..:.:..::.........|:.|. :|.|
  Fly   223 RDLQLAIEKILVARDRPHMAKQLKVL---ITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGL 284

  Fly   286 VIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYT------ 344
            :.|.|              :..||..:::.|:...:|.  .:.|.||||:.....|:.|      
  Fly   285 LCALS--------------FKAYTNPMANYIYAIWFGA--KTVELLSLGQIGSDLAFTTDSLSTM 333

  Fly   345 -----WDR---------ETRRRVFLIILRAQRPITVRVPFFAPSLPVF 378
                 |::         |..|.:.||.|..:..   ..||:...|..|
  Fly   334 YYLTHWEQILQYSTNPSENLRLLKLINLAIEMN---SKPFYVTGLKYF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 47/243 (19%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 47/243 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.