DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or33b

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:374 Identity:86/374 - (22%)
Similarity:144/374 - (38%) Gaps:102/374 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WL--HLLWLVFNFV--NLAHCCQAEFVFGW--SHL--------------RTSPVDAMDAFCPLAC 81
            ||  |||.|..||.  .|.......||..|  .||              :..|:.|       ||
  Fly    18 WLYWHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFMERSLGDVCKGLPITA-------AC 75

  Fly    82 SFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVA-----QRSYYLMVTRCGMLVFT 141
            .|.: ||.....::..|:.:    |.:|..|.::|..||.:..     .|.....:.:..::.:.
  Fly    76 FFAS-FKFICFRFKLSEIKE----IEILFKELDQRALSREECEFFNQNTRREANFIWKSFIVAYG 135

  Fly   142 LGSITTGAFVL-----RSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWSGQVTV 201
            |.:|:..|.||     :.|:..|      |.:|:....|            :|:|..|       
  Fly   136 LSNISAIASVLFGGGHKLLYPAW------FPYDVQATEL------------IFWLSVT------- 175

  Fly   202 YAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKP---------IRDPSLRESKI----------C 247
            |..||..             |..|:....|:..|         :|..::|.|:|          .
  Fly   176 YQIAGVS-------------LAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLT 227

  Fly   248 CQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN--IIRYVVYTF 310
            .::|.:.::.|.::.|||:.....|.......|:|:.:.|:.::::||.::..|  |..|.||..
  Fly   228 GKQLIESIEDHRKLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFL 292

  Fly   311 TVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILR 359
            ::...:|..||.||.:|.|...|..|.|||.|.:.:| :..|:.||.::
  Fly   293 SMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNR-SYSRILLIFMQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 72/323 (22%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 72/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.