DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or33a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:356 Identity:66/356 - (18%)
Similarity:127/356 - (35%) Gaps:98/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LACSFTTLFKLGWMWWRRQEV-------ADLMDRIRLLIGEQEK----REDSR-RKVAQRSYYLM 131
            |.||    :|.....|:.:|:       .||..|:.   .|:|:    :..|| .::..:||.:.
  Fly    74 LFCS----YKFFCFRWKLKEIKTIEGLLQDLDSRVE---SEEERNYFNQNPSRVARMLSKSYLVA 131

  Fly   132 VTRCGMLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWS 196
            .....:.....|..:||                        |.|.:     :.|||         
  Fly   132 AISAIITATVAGLFSTG------------------------RNLMY-----LGWFP--------- 158

  Fly   197 GQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDI-------QDALKPI------------------ 236
                 |.|..|...:     :::|..||:...:       .|:..||                  
  Fly   159 -----YDFQATAAIY-----WISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSR 213

  Fly   237 --RDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSG 299
              .|..|..|: ..::|.:.:..|.::.||::.....:.......|:|:.:.|:.::|:||.::.
  Fly   214 IGHDVKLSSSE-NTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAE 277

  Fly   300 YN--IIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQR 362
            .|  ::.|.|:...:...:|..||.|..|:.|...|..|.:||.|...|:...|.:.:::.....
  Fly   278 NNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLV 342

  Fly   363 PITVRV-PFFAPSLPVFTSVIKFTGSIVALA 392
            |:.::. ......:..|.:.::...|...||
  Fly   343 PVNIKAGGIVGIDMSAFFATVRMAYSFYTLA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 63/348 (18%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 63/348 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.