DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or30a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:316 Identity:66/316 - (20%)
Similarity:135/316 - (42%) Gaps:77/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTLGSITTGAFVLRSL--------WEMWVRR 162
            |.:|:     :|.:|..|       :::|..:|   :|..|...||...:        :.|::..
  Fly   111 INILV-----KETTRLSV-------LISRINLL---MGCCTCIGFVTYPIFGSERVLPYGMYLPT 160

  Fly   163 HQEFKFDMPFRMLFHDFAHRMPWFPV-FYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALR 226
            ..|:|:..|:..:|  |..:....|: ..:|..::..|..            |||:...:.:.|:
  Fly   161 IDEYKYASPYYEIF--FVIQAIMAPMGCCMYIPYTNMVVT------------FTLFAILMCRVLQ 211

  Fly   227 YDIQDALKPIRDPSLRESKICC----QRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVS----- 282
            :.:: :|:.:::..:|...|.|    .:|:..||..|             |..|.:|.|.     
  Fly   212 HKLR-SLEKLKNEQVRGEIIWCIKYQLKLSGFVDSMN-------------ALNTHLHLVEFLCFG 262

  Fly   283 -------ASLVIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSS 340
                   .||:||.::...::     :|.|:|..|  ::::.|| |...|:..:|..:..|||.|
  Fly   263 AMLCVLLFSLIIAQTIAQTVI-----VIAYMVMIF--ANSVVLY-YVANELYFQSFDIAIAAYES 319

  Fly   341 AWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395
            .|..:|.:|::.:..:|:|:|:|:.:.|....| :|.:..|::....|...|.:.:
  Fly   320 NWMDFDVDTQKTLKFLIMRSQKPLAILVGGTYPMNLKMLQSLLNAIYSFFTLLRRV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 64/305 (21%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 64/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.