DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or22b

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:412 Identity:82/412 - (19%)
Similarity:152/412 - (36%) Gaps:95/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YSFGLLGLRFGKEQSW-LHL-LWLVF----NFVNLAHCCQAEFV-----FGWSHLRTSPVDAMDA 75
            :||   |....:.:.| ||. ||..|    .|:.|......|::     |......:|....::.
  Fly    32 WSF---GWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNM 93

  Fly    76 FCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKR--EDSRRKVAQRSYYLMVTRCGML 138
            :.....|:.|:  :|:.  :|||.       ::.:.|.:||  .|..|.:..|...|     |..
  Fly    94 YGSSFKSYLTM--MGYK--KRQEA-------KMSLDELDKRCVCDEERTIVHRHVAL-----GNF 142

  Fly   139 VFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPV------FYLYSTWSG 197
            .:....|...:|::.:.....::|             .|  |.|| :||.      ||:.|.   
  Fly   143 CYIFYHIAYTSFLISNFLSFIMKR-------------IH--AWRM-YFPYVDPEKQFYISSI--- 188

  Fly   198 QVTVYAFAGTDGFFFGFTLYM-------------------AFLLQALRYDIQDALKPIRDPSLRE 243
                     .:....|:.::|                   ..|.|.|| :::.......|..|:|
  Fly   189 ---------AEVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLR-NLRSEPGRTEDEYLKE 243

  Fly   244 SKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNI-IRYVV 307
                   |||.|..|..|...|.....:.:...||.|:...:|:..|:|:|:.:|..:. :..|:
  Fly   244 -------LADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVL 301

  Fly   308 YTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFF 371
            :...||...|.:||....:..:...:.::.:.|.|.:.||..:..:...:...|:||.:.. ..|
  Fly   302 FMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVF 366

  Fly   372 APSLPVFTSVIKFTGSIVALAK 393
            ..|:....:::|...::|.:.|
  Fly   367 PISMQTNLNMVKLAFTVVTIVK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/346 (19%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 67/351 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.