DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or22a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:397 Identity:80/397 - (20%)
Similarity:142/397 - (35%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FG----KEQSWL--HLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMDAF------------C 77
            ||    :.:.|:  :.|||.  |||:.............:|......:...|            .
  Fly    34 FGWTEPENKRWILPYKLWLA--FVNIVMLILLPISISIEYLHRFKTFSAGEFLSSLEIGVNMYGS 96

  Fly    78 PLACSFTTL-FKLGWMWWRRQEVADLMDRIRLLIGEQEKR--EDSRRKVAQRSYYLMVTRCGMLV 139
            ...|:||.: ||      :|||...|:|::       :||  .|..|....| |..|    |...
  Fly    97 SFKCAFTLIGFK------KRQEAKVLLDQL-------DKRCLSDKERSTVHR-YVAM----GNFF 143

  Fly   140 FTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPV------FYLYSTWSGQ 198
            ..|..|....||:               .:.|:.:|....|.|| :||.      ||:.|     
  Fly   144 DILYHIFYSTFVV---------------MNFPYFLLERRHAWRM-YFPYIDSDEQFYISS----- 187

  Fly   199 VTVYAFAGTDGFFFGFTLYMAFLLQALRYD-----IQDALKPIRDPSLRESKICCQRLADIVDRH 258
             ....|..|:..:......:..|:..|...     ::..|:.:|....|......:.|.:.:..|
  Fly   188 -IAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDH 251

  Fly   259 NEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGY-NIIRYVVYTFTVSSAIFLYCYG 322
            ..:...|.....:.:...||.|:....|:..|:|:::.:|.: ..:...::.|.||...|.:||.
  Fly   252 RLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYL 316

  Fly   323 GTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSLPVFTSVIKFTG 386
            ...:..:...:....:.|.|.:.||..:..:...:...|:|||:.. ..|..|:....:::|...
  Fly   317 CNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAF 381

  Fly   387 SIVALAK 393
            |:|.:.|
  Fly   382 SVVTVIK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/345 (19%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 67/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.