DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or82a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:347 Identity:91/347 - (26%)
Similarity:149/347 - (42%) Gaps:57/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LACSFT---TLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSR-----------RKVAQ---R 126
            |:..||   |:.|:......|::..:::.|.|.: .||......|           .|:|.   |
  Fly    65 LSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKM-HEQSASHIPRYREGLDYVAEANKLASFLGR 128

  Fly   127 SYYLMVTRCGM--LVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVF 189
            :|   ...||:  |.|.||.|.. ..|.|     |.....:.:..||.:..|:|.  ..|.:.|.
  Fly   129 AY---CVSCGLTGLYFMLGPIVK-IGVCR-----WHGTTCDKELPMPMKFPFNDL--ESPGYEVC 182

  Fly   190 YLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADI 254
            :||:.....|.|...:..||.|..|.:.:....|.|:..|::...|..:|   :::|   ||..|
  Fly   183 FLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEP---DTQI---RLKSI 241

  Fly   255 VDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIAT----------SVIDILLYSGYNIIRYVVYT 309
            |:.|..:..:.::...|........||..||.:..          ||:|:|||:.:         
  Fly   242 VEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASF--------- 297

  Fly   310 F-TVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP 373
            | ::...:|:|||||..:..|||.:..|...|.|:....:||..:.||||::|:.:.:|..||..
  Fly   298 FGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFVA 362

  Fly   374 SLPVFTSVIKFTGSIVALAKTI 395
            ||..|..:.:...|::.|.|:|
  Fly   363 SLANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 87/336 (26%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 87/335 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.