DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or2a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:400 Identity:84/400 - (21%)
Similarity:157/400 - (39%) Gaps:91/400 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLWLVFNF-VNLAHCCQAEFVFGWSHL-RTSPVDAMDAFCP-LACSFTTL---FKLGWMWWRRQE 98
            ||::|::. |||.    ...:|..|.| |......|...|. |..:.|.:   .|...::..|::
  Fly    36 LLYVVYSITVNLV----VTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLKFANVYMVRKQ 96

  Fly    99 VADLMDRIRL------LIGEQEKREDSRRKV--AQRSYYLMVTRCGMLVFTLGSITTGAFVLRSL 155
            :.::...:||      |:|:.|:....|::|  ||.::     |....:|..|:..:...|:   
  Fly    97 LHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTF-----RTFASIFVFGTTLSCVRVV--- 153

  Fly   156 WEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWS-GQVTVYAFAGTDGFFFGFTLYMA 219
                ||..:|..:.              .||.|.:::||.: ..:.:|...|             
  Fly   154 ----VRPDRELLYP--------------AWFGVDWMHSTRNYVLINIYQLFG------------- 187

  Fly   220 FLLQALRYDIQDALKP---------IRDPSLRESKICC-------------------QRLADIVD 256
            .::||::....|:..|         :|...||..:|.|                   |.|.:.:.
  Fly   188 LIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIR 252

  Fly   257 RHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN----IIRYVVYTFTVSSAIF 317
            ....:.::.:....:::.|....||.::.|..|..:..|..:..:    :|..:|:...|:..:|
  Fly   253 DLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVF 317

  Fly   318 LYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSLPVFTSV 381
            :.||.|..|.|:|.:|.:|.|...|.....:.:|.:...:.|.|||..:.. .:.|.||..|..|
  Fly   318 VICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQV 382

  Fly   382 IKFTGSIVAL 391
            ::||.|:..|
  Fly   383 MRFTYSVFTL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 71/363 (20%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 71/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.