DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or1a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:332 Identity:66/332 - (19%)
Similarity:126/332 - (37%) Gaps:47/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TTLFKLGWMWWRRQEVADLMDRIRL------LIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTL 142
            ::|.|:.....:..::.||:.:|:.      |:|.:.:.::.|.::....|::|...        
  Fly    81 SSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMAAIYFMMCAG-------- 137

  Fly   143 GSITTGAFVLRSLWEMWVRRHQ--EFKFDMPFRMLF-------HDFAH---RMPWFPVFYLYSTW 195
               |:.:|:|..:....::.|.  ||.....||:|.       |.:|.   .|.:...|:..|| 
  Fly   138 ---TSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCCLMVFVLSFFCCST- 198

  Fly   196 SGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADIVDRHNE 260
            :|..|:|.:..     .|.:|....|.|.|: .|.....|.|...         .|:.|...|..
  Fly   199 TGVDTLYGWCA-----LGVSLQYRRLGQQLK-RIPSCFNPSRSDF---------GLSGIFVEHAR 248

  Fly   261 IEKIVKEFSGIMAAPTFVHFVSASLVIATSVID-ILLYSGYNIIRYVVYTFTVSSAIFLYCYGGT 324
            :.|||:.|:.......||..|....:..:.:.. |:.::..|......::..|::.:.:|.:|..
  Fly   249 LLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFSLVVTTQLCIYLFGAE 313

  Fly   325 EMSTESLSLGEAAYS-SAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSLPVFTSVIKFTGSI 388
            ::..|:.......|. ..|.....:.|:.....|.||||...:...||....|:...:.:..||.
  Fly   314 QVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYFFELGRPLLVWIFRTAGSF 378

  Fly   389 VALAKTI 395
            ..|...:
  Fly   379 TTLMNAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 63/321 (20%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 63/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.