DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or69a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:428 Identity:82/428 - (19%)
Similarity:152/428 - (35%) Gaps:90/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PRF---------LSRNYPLAKHLFFVTRYSFGLLGLRFGKEQSWLHLLWLVFNFVNLAHCCQAEF 58
            ||:         :.||  |||.:.|                  ||..:.||::.:.    |....
  Fly    20 PRYTWNGRRSLEVKRN--LAKRIIF------------------WLGAVNLVYHNIG----CVMYG 60

  Fly    59 VFGWSHLRTSPVDAMDAFCPLA--CSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRR 121
            .||....: .|:..:.....:|  ..||.:..|. :|    ::..|......|:.|.|:.....:
  Fly    61 YFGDGRTK-DPIAYLAELASVASMLGFTIVGTLN-LW----KMLSLKTHFENLLNEFEELFQLIK 119

  Fly   122 KVAQRSYYLMVTRCGMLVFTLGSITTGAFVLRSL-WEMWVRRHQEFKFDMPFRMLFHDFAHRMPW 185
            ..|.|.::........:..|....|:......|| ..:.:|.|......:.:|:      ....|
  Fly   120 HRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRI------QSNTW 178

  Fly   186 FPVFYLYSTWSGQVTV---YAFAGTDGF-----------------FFGFTLYMAFLLQALRYDIQ 230
            :|       |..|.::   :|......|                 |||..|.:.|...|.:.:..
  Fly   179 YP-------WQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETI 236

  Fly   231 DALKPIRDPSLRESKICCQRLADIVDRHNEIEK--IVKEFSGIMAAPTFVHFVSASLVIATSVID 293
            ||..|.....|:...:...:|.::.||.|....  .:...|..|.:..|:.|........||:..
  Fly   237 DARNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKH 301

  Fly   294 ILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIIL 358
            :|     .::.::.|.|::       |..||.:...|..:..||:.:.||..|...||.:.::::
  Fly   302 LL-----GLLLFITYNFSM-------CRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMM 354

  Fly   359 RAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395
            ||.:|...:....|| |:..:.:.:||:..:....:::
  Fly   355 RATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/343 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 66/338 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.