DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT10A

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_079492.2 Gene:WNT10A / 80326 HGNCID:13829 Length:417 Species:Homo sapiens


Alignment Length:381 Identity:142/381 - (37%)
Similarity:194/381 - (50%) Gaps:50/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IMEIRLVSS--FTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCS 77
            |:::||...  ..:..:|..:|||:..|..:|...||...:..:|.|:...|||||||..|||||
Human    44 ILDLRLPPEPVLNANTVCLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCS 108

  Fly    78 EVWQRNVFAHVIPTAS---REAAYTYAIASAGAAYAVTAACARGNISTCGCDV------------ 127
            .:..||...:..|..|   ||:|:.||||:||..:||:.|||.|.:..||||.            
Human   109 SLETRNKIPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRK 173

  Fly   128 --------------------RHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDS 172
                                .|.|.||......:.|:|||||.|:.||.|:::.|:|:||..||.
Human   174 LHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDI 238

  Fly   173 RTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAV 237
            ...|.|||||.||..|.:.:|..|||||.||||.:||||:..|.||.||..|..::.:|..::. 
Human   239 HARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLIRP- 302

  Fly   238 KGKRGLRLVLSRKKHAGTARAQKPV--LDWPKR----MELIYLEASPNYCERSLQTGSQGTSGRT 296
            ..:.|.:|      ..|.|.|..|.  ...|:|    .:|:|.|.||::|||..:..|.||.||.
Human   303 HNRNGGQL------EPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGRL 361

  Fly   297 CQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |.::..|...|..:|||||||.....|:.:|.|:|.|||.|.|:||..:.....||
Human   362 CNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 134/356 (38%)
WNT10ANP_079492.2 Wnt 58..417 CDD:393294 137/365 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..331 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.