DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt9a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005163718.1 Gene:wnt9a / 751644 ZFINID:ZDB-GENE-060825-97 Length:363 Species:Danio rerio


Alignment Length:328 Identity:116/328 - (35%)
Similarity:179/328 - (54%) Gaps:27/328 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTAS 93
            ||.|:. |...||.|||..|.....|.|...:.|.|||:|||..||||:  .:....|:::....
Zfish    58 LCDRLK-LEKKQRRMCRRDPGVAETLMEAISMSALECQYQFRFERWNCT--LEGRYRANILKRGF 119

  Fly    94 REAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPD----EPWKWGGCSADVDF 154
            :|.|:.|||:|||..:|:..||:.|.:..|.||          ..||    :.|:||||..::.:
Zfish   120 KETAFLYAISSAGLTHAMAKACSAGRMERCTCD----------EAPDLENRKAWQWGGCGDNLKY 174

  Fly   155 GMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRL 219
            ..::.:.|:..|. .:|.|..:::||:..|..::|..:.|.||||||||||.::|||:.|.||..
Zfish   175 SNKFVKDFLGKRS-NKDLRARIDMHNSNVGMKVIKTGVETTCKCHGVSGSCTVQTCWRQLAPFHE 238

  Fly   220 VGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERS 284
            :|.:|..:|:.:..|.:...:......:|:.:   :...|.|..|.|:..:|:::|.||::|..|
Zfish   239 IGKQLKQRYETSVKVASSTNEATGEGEISQSR---SQSQQPPQPDIPRTPDLLHIEDSPSFCRPS 300

  Fly   285 LQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEF 349
            ..  |.||..|.|.:    .::|:.:|||||||||....|..|:||.||||.|:|.:|.:..|.:
Zfish   301 KY--SAGTLARKCYK----DKNCEAICCGRGHNTQSRVVTRPCQCQVRWCCYVECKQCTQKEEVY 359

  Fly   350 TCK 352
            |||
Zfish   360 TCK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 111/319 (35%)
wnt9aXP_005163718.1 wnt 64..362 CDD:278536 111/319 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.