DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT10B

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens


Alignment Length:363 Identity:129/363 - (35%)
Similarity:183/363 - (50%) Gaps:51/363 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAH-- 87
            |:..:|..:.||:..|..:|...||...:..:|..:...|||||.|..|||||.:.......|  
Human    43 TANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHS 107

  Fly    88 -VIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVR----------------------- 128
             ::....||:|:::::.:||..:||..||:.|.:.:|||..:                       
Human   108 AILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKS 172

  Fly   129 --HKATPTGGGT-----PDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRT 186
              |.....|.|:     |.:.|:||||:.|:|||.:::|.|:|:||..||.:..|.:||||.||.
Human   173 FPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQ 237

  Fly   187 LVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKK 251
            :|.:.|:..|||||.||||..||||::.|.||.||..|..:..:|..:..               
Human   238 VVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDT--------------- 287

  Fly   252 HAGTARAQKPVLDWPKRM--ELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGR 314
            |...:.|.:|.|. |:|:  ||:|.|.||::|||....||.||.||.|.:|......|..|||||
Human   288 HNRNSGAFQPRLR-PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGR 351

  Fly   315 GHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |||.....|..:|.|:|.|||.|.||||..:.....||
Human   352 GHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWVNVCK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 124/350 (35%)
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 126/359 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.