DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT8A

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens


Alignment Length:298 Identity:122/298 - (40%)
Similarity:168/298 - (56%) Gaps:20/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACA 116
            :|||.  |.|.:||:.||...||||.|...:....:.:.:|:||.::.:||:|||..|.:|..|:
Human    83 VALGA--QSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCS 145

  Fly   117 RGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNN 181
            .|:...||||..:.....|.|     |.|||||.:|:||.|.::.|:|:.|..:|:|.|||||||
Human   146 MGDFENCGCDGSNNGKTGGHG-----WIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNN 205

  Fly   182 RAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLV 246
            ||||..|:..::..|||||:||||.::|||..|..||.:||.|..||.:|..::  ..||.||..
Human   206 RAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIE--MDKRQLRAG 268

  Fly   247 LSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGP-----QS 306
            .|.:.|...|.|..|..:    .|||:||.||:||..:...|..||.||.|.:..|..     :|
Human   269 NSAEGHWVPAEAFLPSAE----AELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRS 329

  Fly   307 CDLLC--CGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 342
            |..||  ||.....:.....:.|.|:|:|||.||||:|
Human   330 CGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 122/298 (41%)
WNT8AXP_016865313.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.