DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT2

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_003382.1 Gene:WNT2 / 7472 HGNCID:12780 Length:360 Species:Homo sapiens


Alignment Length:343 Identity:145/343 - (42%)
Similarity:213/343 - (62%) Gaps:25/343 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIMEIRLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSE 78
            |.|.   .:..:|.::|..:|||...||.:|...||.:.|:.:|......|||||||.|||||:.
Human    28 WYMR---ATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNT 89

  Fly    79 V-WQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEP 142
            : ...::|..|:..:|||:|:.|||:|||..:|:|.||::|.:.:|.||.:..     |...|..
Human    90 LDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKM-----GSAKDSK 149

  Fly   143 --WKWGGCSADVDFGMRYARRFMDARELE-RDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGS 204
              :.|||||.::|:|:::||.|:||:|.: :|:|.|||||||||||..||:.|:.:|||||||||
Human   150 GIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGS 214

  Fly   205 CVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRM 269
            |.::|||.::..||..||.|..||..|  :|.|..:.|....::.:      |.:||.     :.
Human   215 CTLRTCWLAMADFRKTGDYLWRKYNGA--IQVVMNQDGTGFTVANE------RFKKPT-----KN 266

  Fly   270 ELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWC 334
            :|:|.|.||:||.|..:.||.||:||.|..|..|..||:::|||||::|.|:.|.|:|.|:|.||
Human   267 DLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWC 331

  Fly   335 CEVKCDECDESYEEFTCK 352
            |.|:|.:|.|:.:..|||
Human   332 CAVRCQDCLEALDVHTCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 137/319 (43%)
WNT2NP_003382.1 wnt 43..349 CDD:306592 139/323 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.