DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt5a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001073303.1 Gene:wnt5a / 568191 ZFINID:ZDB-GENE-060328-3 Length:374 Species:Danio rerio


Alignment Length:334 Identity:138/334 - (41%)
Similarity:192/334 - (57%) Gaps:31/334 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTAS 93
            ||.::.||:.||:.:|:...|.:..:|||.:.|.:|||||||..|||||.|....|...|:...|
Zfish    62 LCSQLSGLSKGQKKLCQLYQDHMQYIGEGAKTGIRECQHQFRHRRWNCSTVDNSTVLGRVMHIGS 126

  Fly    94 REAAYTYAIASAGAAYAVTAACARGNISTCGCD--VRHKATPTGGGTPDEPWKWGGCSADVDFGM 156
            ||:|:.:||::||..:||:.||..|.:|:|||.  .|.|..|       ..|.||||..::::|.
Zfish   127 RESAFAFAISAAGVLHAVSRACREGALSSCGCSRASRPKDLP-------RDWLWGGCGDNLNYGY 184

  Fly   157 RYARRFMDARELER--------DSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKS 213
            |::|.|:||||.|:        .:|.:||||||.|||.:|..:....||||||||||.:||||..
Zfish   185 RFSREFVDAREREKTFSKGSAESARQMMNLHNNEAGRRIVSDLADVSCKCHGVSGSCSLKTCWLQ 249

  Fly   214 LPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASP 278
            |..||.|||.|..||..|..:: :.| || :||....|.:.           |...:|:||:.||
Zfish   250 LADFRKVGDVLKEKYDSAAAMR-MNG-RG-KLVQMHSKFSP-----------PSGQDLLYLQPSP 300

  Fly   279 NYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECD 343
            :||.|:..:||.||.||.|.:|..|...|.|:|||||::........:|.|:|.|||.|:|..|.
Zfish   301 DYCIRNSSSGSLGTQGRLCNKTSEGMDGCALMCCGRGYDQYKAELVERCHCKFHWCCYVRCKRCS 365

  Fly   344 ESYEEFTCK 352
            ...:::.||
Zfish   366 SIVDQYVCK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 133/325 (41%)
wnt5aNP_001073303.1 wnt 69..374 CDD:278536 133/325 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.