DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt9b

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001131132.1 Gene:wnt9b / 565677 ZFINID:ZDB-GENE-080201-1 Length:358 Species:Danio rerio


Alignment Length:322 Identity:114/322 - (35%)
Similarity:168/322 - (52%) Gaps:32/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTY 100
            ||..|:.:||..|.....|.|..:|...||::|||..|||||    .:....::....:|.|:..
Zfish    62 LTRRQKRLCRREPGLAETLRESVRLSLLECRYQFRNERWNCS----MDGRGSLLKRGFKETAFLL 122

  Fly   101 AIASAGAAYAVTAACARGNISTCGCD----VRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARR 161
            |::||..::|:..||:.|.:..|.||    ::|:          |.|:||.|..::.:..::.::
Zfish   123 AVSSAALSHALAKACSSGRMERCTCDDSPGLQHR----------EAWQWGVCGDNLKYSTKFLKK 177

  Fly   162 FMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLML 226
            |:..:.:.:|.|..::.||...|...||..|:|.||||||||||.::||||.|.||:..|..|..
Zfish   178 FLGQKRVSKDLRAQIDAHNINVGIRAVKSGLKTTCKCHGVSGSCAVRTCWKQLSPFQDTGHLLKY 242

  Fly   227 KYQKAKTVQAV-KGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQ 290
            :|..|..|.:| ....|...:...::|:.|       |..|:..||::||.||::|..|..  |.
Zfish   243 RYDTAVRVHSVTNSATGETELAGPRRHSIT-------LPRPRPTELVFLEESPSFCRPSRY--SP 298

  Fly   291 GTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            ||:||.|.:    ..||..||||||:||.....|..|.||.||||.|:|..|....|.:|||
Zfish   299 GTAGRPCSK----DTSCSSLCCGRGYNTALRLTTLSCHCQVRWCCHVECQTCLREEEVYTCK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 112/320 (35%)
wnt9bNP_001131132.1 Wnt_Wnt9b 62..356 CDD:381728 112/320 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.