DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT4

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011539899.1 Gene:WNT4 / 54361 HGNCID:12783 Length:373 Species:Homo sapiens


Alignment Length:350 Identity:139/350 - (39%)
Similarity:201/350 - (57%) Gaps:36/350 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIMEIRLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSE 78
            ::.::..|.|.:....|.::.||...|..||:...:.:.::..|.||..:|||:|||..|||||.
Human    49 YLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCST 113

  Fly    79 VWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCD-VRHKATPTGGGTPDEP 142
            :....||..|:...:||||:.|||:|||.|:|||.||:.|.:..|||| ..|..:|.|       
Human   114 LDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG------- 171

  Fly   143 WKWGGCSADVDFGMRYARRFMDARELER---DSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGS 204
            ::|.|||.::.:|:.:::.|:|.||..:   .||.|||||||.|||..:...:|.:|||||||||
Human   172 FQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGS 236

  Fly   205 CVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQ-------KPV 262
            |.:||||:::||||.||..|..|:..|..|:              .:..|::||.       ||.
Human   237 CEVKTCWRAVPPFRQVGHALKEKFDGATEVE--------------PRRVGSSRALVPRNAQFKPH 287

  Fly   263 LDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQC 327
            .|    .:|:|||.||::||:.:::|..||.||||.:|......|:|||||||.:|..:....:|
Human   288 TD----EDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERC 348

  Fly   328 RCQFRWCCEVKCDECDESYEEFTCK 352
            .|:|.|||.|||.:|....|..||:
Human   349 SCKFHWCCFVKCRQCQRLVELHTCR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 134/326 (41%)
WNT4XP_011539899.1 wnt 71..373 CDD:278536 134/326 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40508
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.