DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and WNT16

DIOPT Version :10

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_476509.1 Gene:WNT16 / 51384 HGNCID:16267 Length:365 Species:Homo sapiens


Alignment Length:86 Identity:25/86 - (29%)
Similarity:37/86 - (43%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 IDGTITKSDVLGHILPMVGKSWDQIGVAQ-LFSKIEENGYKMLY-------LSARAIGQAKTTRG 949
            :|.|.|:..|.|..:.:..|.....|:.. ||...:|.|...||       |...:.|..|.  |
Human    26 VDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKI--G 88

  Fly   950 YLQSIRQGDV-KLPDGPLLLN 969
            ..||:::..| :|.|..||:|
Human    89 IYQSLKRLFVERLEDETLLIN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 Wnt_Wnt7 29..352 CDD:381713
WNT16NP_476509.1 Wnt_Wnt16 52..365 CDD:381718 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.