DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt10a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001101697.1 Gene:Wnt10a / 316527 RGDID:1307015 Length:417 Species:Rattus norvegicus


Alignment Length:365 Identity:140/365 - (38%)
Similarity:186/365 - (50%) Gaps:48/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTAS 93
            :|..:|||:..|..:|...||...:..:|.|:...|||||||..|||||.:..||...:..|..|
  Rat    60 VCLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYESPIFS 124

  Fly    94 ---REAAYTYAIASAGAAYAVTAACARGNISTCGCDV---------------------------- 127
               ||:|:.||||:||..:||:.|||.|.:..||||.                            
  Rat   125 RGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLS 189

  Fly   128 ----RHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLV 188
                .|.|.|.......:.|:|||||.||.||.|:::.|:|:||..||....|.|||||.||..|
  Rat   190 HGVPEHPAIPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAV 254

  Fly   189 KKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHA 253
            .:.:|..|||||.||||.:||||:..|.||.||..|..::.:|..::. ..:.|.:|      ..
  Rat   255 MENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLIRP-HNRNGGQL------EP 312

  Fly   254 GTARAQKPVLDWP------KRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCC 312
            |.|.|..|....|      ...:|:|.|.||::|||..:..|.||.||.|.::..||.||..:||
  Rat   313 GLAGAPSPAPGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSTGPDSCGSMCC 377

  Fly   313 GRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |||||.....|:.:|.|:|.|||.|.|:||..:.....||
  Rat   378 GRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 135/356 (38%)
Wnt10aNP_001101697.1 wnt 67..417 CDD:278536 135/356 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.