DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt9b

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001100525.1 Gene:Wnt9b / 303586 RGDID:1309574 Length:359 Species:Rattus norvegicus


Alignment Length:318 Identity:114/318 - (35%)
Similarity:163/318 - (51%) Gaps:22/318 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTY 100
            |:..|:.:||..|.....|.:...||..|||.|||..|||||...:..    ::....:|.|:.|
  Rat    62 LSRWQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTG----LLQRGFKETAFLY 122

  Fly   101 AIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA 165
            |:::|...:|:..||:.|.:..|.||      .:.|....:.|:||.|..::.:..::...|:..
  Rat   123 AVSAAALTHALARACSAGRMERCTCD------DSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGP 181

  Fly   166 RELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQK 230
            :...:|.|...:.||...|...||..|||.||||||||||.::||||.|.|||..|..|.|:|..
  Rat   182 KRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDT 246

  Fly   231 AKTVQAVKGKRGLRLVL-SRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSG 294
            |..|.:...:...||.| ...|..|.|:...     |:.::|:|:|.||::|..|..  |.||:|
  Rat   247 AVKVSSATNEALGRLELWVPAKPGGPAKGLA-----PRPVDLVYMEDSPSFCRPSKY--SPGTAG 304

  Fly   295 RTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |.|.|    ..||..||||||::||.......|.||.:|||.|:|.:|.:....:|||
  Rat   305 RVCSR----DTSCSSLCCGRGYDTQSRMVAFSCHCQVQWCCYVECQQCAQQELVYTCK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 112/316 (35%)
Wnt9bNP_001100525.1 wnt 62..358 CDD:278536 112/316 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.