DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt3a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001100475.2 Gene:Wnt3a / 303181 RGDID:1308057 Length:359 Species:Rattus norvegicus


Alignment Length:346 Identity:158/346 - (45%)
Similarity:203/346 - (58%) Gaps:20/346 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILWIMEI--RLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRW 74
            :||.:.:  :..|..|..:||..||||.|.|...||...:.:.::.||.:.|.|||||||||.||
  Rat    29 LLWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRW 93

  Fly    75 NCSEVWQR-NVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGT 138
            ||:.|... .:|..|:..|:||:|:.:||||||.|:|||.:||.|:.:.|||..|.:      |:
  Rat    94 NCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQ------GS 152

  Fly   139 PDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSG 203
            |.|.|||||||.|::||...:|.|.||||...|:|:.||.|||.|||..:...:...|||||:||
  Rat   153 PGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG 217

  Fly   204 SCVMKTCWKSLPPFRLVGDRLMLKYQKAK--TVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWP 266
            ||.:||||.|.|.||.:||.|..||..|.  .|:..:..||         ...|.|.:......|
  Rat   218 SCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRG---------WVETLRPRYTYFKVP 273

  Fly   267 KRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQF 331
            ...:|:|.|||||:||.:.:|||.||..|||..:.||...|||||||||||.:..||..:|.|.|
  Rat   274 TERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVF 338

  Fly   332 RWCCEVKCDECDESYEEFTCK 352
            .|||.|.|.||...|:..|||
  Rat   339 HWCCYVSCQECTRVYDVHTCK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 147/318 (46%)
Wnt3aNP_001100475.2 WNT1 51..359 CDD:128408 150/322 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.