DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt10a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio


Alignment Length:357 Identity:140/357 - (39%)
Similarity:190/357 - (53%) Gaps:44/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAH---VIP 90
            :|..:||||..|.::|...||...:..:|.|:...||||||||||||||.:..||...:   |..
Zfish    97 VCLTLPGLTKKQLDVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRNKIPYESVVFS 161

  Fly    91 TASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHK----------------ATPTGGGT- 138
            ...||:|:.||||:||..:||:.|||.|.:..||||.:.:                |...|.|. 
Zfish   162 RGFRESAFAYAIAAAGVVHAVSNACAMGKLKACGCDEKRRGDEEAFRIKLNRLQLEAINRGKGMV 226

  Fly   139 -------------PDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKK 190
                         |.:.|:|||||.:|::|.|:::.|:|:||..||..:.|.|||||.||.:|..
Zfish   227 HGVMEHFPAEALGPQDSWEWGGCSPNVEYGERFSKDFLDSRETYRDIHSRMRLHNNRVGRQVVVD 291

  Fly   191 MLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGT 255
            .:|..|||||.||||.:||||:..|.||.||..|..::..|..::|.....|   .:....|...
Zfish   292 HMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGSLLKERFNVATLIKAHNRNTG---QVENAHHTHR 353

  Fly   256 ARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQH 320
            .||        ...:|:|.|.||::|||.|.:.|.||.||.|.:|..|..:|:.||||||||...
Zfish   354 RRA--------NINDLVYFEKSPDFCERDLGSDSAGTQGRICNKTSQGMDNCESLCCGRGHNILQ 410

  Fly   321 IRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            ..|:.:|.|:|.|||.|.|:||..:.....||
Zfish   411 QTRSERCNCKFHWCCYVVCEECRITEWVSVCK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 135/348 (39%)
wnt10aNP_571055.1 wnt 104..442 CDD:278536 135/348 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.