DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt8a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio


Alignment Length:347 Identity:126/347 - (36%)
Similarity:179/347 - (51%) Gaps:28/347 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQ----ECQHQFRGHRWNCSEV 79
            ::.:|....:.|..:........|.....|.|.:|.....|.|||    ||:|||...||||.|.
Zfish     5 QIFASLVMSICCHILSSTAWSVNNFLMTGPKAYLAYTSSVQAGAQSGIEECKHQFAWDRWNCPES 69

  Fly    80 WQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWK 144
            ..:......:.:|:||.|:.:||::||..|.:|..|:.|:...|||| ..|....||    ..|.
Zfish    70 ALQLSTHKGLRSATRETAFVHAISAAGVMYTLTKNCSMGDFENCGCD-DSKIGKMGG----RGWV 129

  Fly   145 WGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKT 209
            |||||.:|:||.|.|:.|:||.|...|||..:|||||.|||..||..|:..|||||:||||.::|
Zfish   130 WGGCSDNVNFGDRIAKLFVDALENGHDSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQT 194

  Fly   210 CWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDW---PKRMEL 271
            ||..|..||.:|..|.:|:.:|:.::..|         .|.:...:|..:..:.|.   ..|.||
Zfish   195 CWMQLADFRDIGSYLKIKHDQARKLEMDK---------IRMRAGNSADNRGAIADTFSAVARTEL 250

  Fly   272 IYLEASPNYCERSLQTGSQGTSGRTCQRTGHG-----PQSCDLLC--CGRGHNTQHIRRTTQCRC 329
            |::|.||:||.::|..|..||.||.|.::|..     .:||..||  ||.....:.|...:.|.|
Zfish   251 IFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERRSCRRLCHECGLKVEERRIETVSSCNC 315

  Fly   330 QFRWCCEVKCDECDESYEEFTC 351
            :|.|||.|||:.|.::...:.|
Zfish   316 KFHWCCTVKCETCTQTVTRYFC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 124/330 (38%)
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 123/328 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.