DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt8a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001099625.1 Gene:Wnt8a / 291678 RGDID:1306312 Length:359 Species:Rattus norvegicus


Alignment Length:318 Identity:127/318 - (39%)
Similarity:172/318 - (54%) Gaps:38/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVF---AHVIPT-ASREAAYTYAIASAGAAYA 110
            |.:|||.  |:|.:||:.||...||||.|    :.|   .|..|. |:||.::.:||.||...||
  Rat    45 ASVALGA--QMGMEECKFQFAWERWNCPE----HAFQFSTHTRPRGATRETSFIHAIRSAAVMYA 103

  Fly   111 VTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTL 175
            ||..|:.|::.|||||..:.....|.|     |.|||||.:|:||.:.:|.|:|:.|..:|:|.|
  Rat   104 VTKNCSMGDLETCGCDESNNGKAGGHG-----WIWGGCSDNVEFGEKISRLFVDSLEKGKDARAL 163

  Fly   176 MNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGK 240
            ||||||||||..|:..::..|||||:||||.::|||..|..||.:|:.|..||.:|..::.  .|
  Rat   164 MNLHNNRAGRLAVRASMKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIET--DK 226

  Fly   241 RGLRLVLSRKKHAGTARAQ---KPVLDW--PKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRT 300
            |.||        ||. ||:   .|:..:  ....|||:||.||:||.|:...|..||.||.|.:.
  Rat   227 RQLR--------AGN-RAEGRWAPIEAFLPSAEAELIFLEGSPDYCNRNASLGIYGTEGRECLQN 282

  Fly   301 GHG-----PQSCDLLC--CGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351
            ...     .:||..||  ||.....:.....:.|.|.|:|||.|||.:|......:.|
  Rat   283 ARSASRWEQRSCGRLCTECGLQVEERRTEAVSSCDCNFQWCCTVKCGQCRRVVNRYYC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 127/318 (40%)
Wnt8aNP_001099625.1 WNT1 25..340 CDD:128408 126/316 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345740
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.