DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt1

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001099184.1 Gene:Wnt1 / 24881 RGDID:1597195 Length:370 Species:Rattus norvegicus


Alignment Length:313 Identity:133/313 - (42%)
Similarity:177/313 - (56%) Gaps:22/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTY 100
            |:..||.:.|:.|..|.::..|.|...:||:.|||..||||......::|..::....||.|:.:
  Rat    64 LSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIF 128

  Fly   101 AIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA 165
            ||.|||..::|..:|:.|:|.:|.||.|.:    |.|.||  |.|||||.::|||..:.|.|:|:
  Rat   129 AITSAGVTHSVARSCSEGSIESCTCDYRRR----GPGGPD--WHWGGCSDNIDFGRLFGREFVDS 187

  Fly   166 RELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQK 230
            .|..||.|.|||||||.||||.|...:|.:|||||:||||.::|||..||..|.|||.|..::..
  Rat   188 GEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDG 252

  Fly   231 AKTVQAVKGKRGLRLVLSRKKHAGTAR------AQKPVLDWPKRMELIYLEASPNYCERSLQTGS 289
            |..|  :.|.||    .:|...|...|      |.||    |...:|:|.|.|||:|..|.:.|:
  Rat   253 ASRV--LYGNRG----NNRASRAELLRLEPEDPAHKP----PSPHDLVYFEKSPNFCTYSGRLGT 307

  Fly   290 QGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 342
            .||:||.|..:......|:||||||||.|:..|.|.:|.|.|.|||.|.|..|
  Rat   308 AGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 133/313 (42%)
Wnt1NP_001099184.1 Wnt_Wnt1 64..370 CDD:381707 133/313 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.