DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt8b

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_035850.2 Gene:Wnt8b / 22423 MGIID:109485 Length:368 Species:Mus musculus


Alignment Length:310 Identity:118/310 - (38%)
Similarity:161/310 - (51%) Gaps:29/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACAR 117
            ::..|.|.|.:||::||...||||.|...:......:.:|:||.|:.:||:|||..|.:|..|:.
Mouse    59 SVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSL 123

  Fly   118 GNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNR 182
            |:...||||........|.|     |.|||||.:|.||...:::|:||.|..:|:|..||||||.
Mouse   124 GDFDNCGCDDSRNGQLGGQG-----WLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNE 183

  Fly   183 AGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVL 247
            |||..||..::..||||||||||..:|||..||.||.||..|..||..|..|..::|        
Mouse   184 AGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG-------- 240

  Fly   248 SRKKHAGTARAQKPVLDWPKR----MELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHG----- 303
                 ||.:.|.:..:....|    .||::||.||:||..:...|..||.||.|.|.|..     
Mouse   241 -----AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE 300

  Fly   304 PQSCDLLC--CGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351
            .:||..||  ||.....:.....:.|.|:|.|||.|:|::|.....::.|
Mouse   301 RRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 118/310 (38%)
Wnt8bNP_035850.2 WNT1 39..350 CDD:128408 117/308 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.