DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt6

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus


Alignment Length:371 Identity:148/371 - (39%)
Similarity:193/371 - (52%) Gaps:45/371 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIYIL---------WIMEIRLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQ 63
            ||:.:|         |.:...||...||:  |.:...|...|..:|:..|:.:..|..|.:||.:
Mouse    11 LLLLLLCPAHVDGLWWAVGSPLVMDPTSI--CRKARRLAGRQAELCQAEPEVVAELARGARLGVR 73

  Fly    64 ECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDV- 127
            |||.|||..|||||.  ....|..|:....||.|:.:||.:|||::|||.||:.|.:..|||.. 
Mouse    74 ECQFQFRFRRWNCSS--HSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAP 136

  Fly   128 RHKATPTGG---GTPDEP-----------WKWGGCSADVDFGMRYARRFMDAREL--ERDSRTLM 176
            |.:|.|...   |||..|           |:||||..|||||...:|.||||:..  ..|.|.|:
Mouse   137 RGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALV 201

  Fly   177 NLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVK-GK 240
            .||||.|||..|:...||:|||||:||||.::|||:.|||||.||.||:.::..|..|.... ||
Mouse   202 QLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGK 266

  Fly   241 RGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQ 305
            ..|..|          |..||    |.|.:|:|...||::|..:.:|||.||.||.|..:.....
Mouse   267 ALLPAV----------RTLKP----PGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLS 317

  Fly   306 SCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351
            .||||||||||..:.::....|.|:|.|||.|:|..|....|...|
Mouse   318 GCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 139/334 (42%)
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 142/348 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.