DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt8a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_033316.2 Gene:Wnt8a / 20890 MGIID:107924 Length:354 Species:Mus musculus


Alignment Length:309 Identity:119/309 - (38%)
Similarity:164/309 - (53%) Gaps:20/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAA 114
            |.:|||.  |:|.:||:.||...||||.|...:....:.:..|:||.::.:||.||...||||..
Mouse    41 ASVALGA--QIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKN 103

  Fly   115 CARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLH 179
            |:.|::..||||........|.|     |.|||||.:|:||.:.:|.|:|:.|..:|:|.|:|||
Mouse   104 CSMGDLENCGCDESQNGKTGGHG-----WIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLH 163

  Fly   180 NNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLR 244
            ||||||..|:...:..|||||:||||.::|||..|..||.:|:.|..||.:|..::  ..||.||
Mouse   164 NNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIE--MDKRQLR 226

  Fly   245 LVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHG-----P 304
            .....:.......|..|..:    .|||:||.||:||.|:.....|||.||.|.:....     .
Mouse   227 AGNRAEGRWALTEAFLPSTE----AELIFLEGSPDYCNRNASLSIQGTEGRECLQNARSASRREQ 287

  Fly   305 QSCDLLC--CGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351
            :||..||  ||.....:.....:.|.|.|:|||.|||.:|......:.|
Mouse   288 RSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 119/309 (39%)
Wnt8aNP_033316.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842311
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.