DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and lin-44

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001021081.1 Gene:lin-44 / 171994 WormBaseID:WBGene00003029 Length:348 Species:Caenorhabditis elegans


Alignment Length:320 Identity:101/320 - (31%)
Similarity:149/320 - (46%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAA 108
            ||..|..:|:..||.|.|.|.|.::.|..:|:|||.........::....||::..:|::||.||
 Worm    70 CRTHPATVISAFEGVQEGLQNCANRLRFQQWDCSEAGNIMHDPPLLRQGFRESSLIWALSSASAA 134

  Fly   109 YAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMD--------A 165
            :.|..|||:|.|..|.|:         .......:::|||:..|..|:..:|:.:.        .
 Worm   135 WGVATACAQGWIDDCACN---------NQMGQNEYEFGGCTHGVQHGITASRKLLTKVGAVNTLL 190

  Fly   166 RELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQK 230
            |::|:        ||.:|||..:||.|.:.||||||||||..|||||.......:.|.|:.||.:
 Worm   191 RKVEK--------HNLKAGRLAIKKTLISSCKCHGVSGSCQQKTCWKRTATLEHITDYLVEKYAR 247

  Fly   231 AK--TVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTS 293
            ||  |..:|                            .|..:||||||||:.|:      ::..:
 Worm   248 AKLYTDDSV----------------------------VKTTDLIYLEASPDVCK------AKSVA 278

  Fly   294 GRTC--QRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351
            ||.|  :...|....||.||||.|.:.:|.....:|.|:|.|||.:.|.:|.:.....||
 Worm   279 GRVCAWRNETHTQGDCDRLCCGNGFSIRHEVVRVKCDCEFVWCCNLVCKDCIQHRWISTC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 101/320 (32%)
lin-44NP_001021081.1 WNT1 64..339 CDD:128408 101/320 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.