DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and Wnt2

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_575397.1 Gene:Wnt2 / 114487 RGDID:621346 Length:360 Species:Rattus norvegicus


Alignment Length:342 Identity:148/342 - (43%)
Similarity:215/342 - (62%) Gaps:23/342 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIMEIRLVSSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSE 78
            |.|.   .:..:|.::|..:|||...||.:|...||.:.|:|.|......|||||||.|||||:.
  Rat    28 WYMR---ATGGSSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNT 89

  Fly    79 V-WQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDE- 141
            : ...::|..|:..:|||:|:.|||:|||..:|:|.||::|.:.:|.||.:.|    |.|...: 
  Rat    90 LDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKK----GSGKDSKG 150

  Fly   142 PWKWGGCSADVDFGMRYARRFMDARELE-RDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSC 205
            .:.|||||.::|:|:::||.|:||:|.: :|:|.|||||||||||..||:.|:.:||||||||||
  Rat   151 TFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSC 215

  Fly   206 VMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRME 270
            .::|||.::..||..||.|..||..|  :|.|..:.|....::.|      |.:||.     :.:
  Rat   216 TLRTCWLAMADFRKTGDYLWRKYNGA--IQVVMNQDGTGFTVANK------RFKKPT-----KND 267

  Fly   271 LIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCC 335
            |:|.|.||:||.|..:.||.||:||.|..|..|..||:::|||||::|.|:.|.|:|.|:|.|||
  Rat   268 LVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFHWCC 332

  Fly   336 EVKCDECDESYEEFTCK 352
            .|:|.:|.|:.:..|||
  Rat   333 AVRCQDCLEALDVHTCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 140/318 (44%)
Wnt2XP_575397.1 wnt 47..349 CDD:278536 135/304 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.