DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt6a

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002662357.3 Gene:wnt6a / 100332722 ZFINID:ZDB-GENE-111114-1 Length:360 Species:Danio rerio


Alignment Length:338 Identity:131/338 - (38%)
Similarity:187/338 - (55%) Gaps:36/338 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTA 92
            ||.||       ..::|:..|:.:..:.:|.:||.:||||||..|||||:.  |....|.::...
Zfish    44 MLAGR-------HTDLCQSQPEIIQEVAKGARLGIRECQHQFHNHRWNCTS--QGRNLAKILQQD 99

  Fly    93 SREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEP------------WKW 145
            .||.|:.||:.:||..:|||.||::|.:..|||.....::.|...:|.|.            |:|
Zfish   100 IRETAFVYAVTAAGVMHAVTQACSQGALPQCGCVTLQSSSETYRVSPAEEVLIQASSLHDWHWEW 164

  Fly   146 GGCSADVDFGMRYARRFMDAREL--ERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMK 208
            |||..|||||...:|:|||.|:.  :.|.|:|::||||.|||..::..:||:|||||:||||.::
Zfish   165 GGCGDDVDFGYEKSRQFMDIRQRKGKSDIRSLIDLHNNEAGRVAIQIQMRTECKCHGLSGSCTLR 229

  Fly   209 TCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIY 273
            :|||.:|.||.|||:||..:..|  |:.:.|..|..||        :.....|.||   ...|||
Zfish   230 SCWKKMPLFRQVGDQLMQSFHTA--VRVMGGNDGKSLV--------SIDPDAPPLD---ANVLIY 281

  Fly   274 LEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVK 338
            ...||::|:.:.::|::||.||.|.||..||..||.||||.|.....:.....|.|:|.|||||:
Zfish   282 SAESPDFCKANHRSGTEGTGGRACNRTETGPGGCDSLCCGNGFADFTVEEEENCECRFHWCCEVQ 346

  Fly   339 CDECDESYEEFTC 351
            |..|.:......|
Zfish   347 CQTCSQRKNVSLC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 127/330 (38%)
wnt6aXP_002662357.3 wnt 45..359 CDD:278536 129/335 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.