DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt7b

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:295 Identity:150/295 - (50%)
Similarity:195/295 - (66%) Gaps:15/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCG 124
            :|..|||:|||..|||||.:.:|.||...:...|||||:||||.:||.|:|||:||::||:|.||
 Frog     1 MGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTSACSQGNLSNCG 65

  Fly   125 CDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGRTLVK 189
            || |.|   .|....:|.|||||||||:.:|:.::|:|:||||:::::|.|||||||.|||.:::
 Frog    66 CD-REK---QGYYNQEEGWKWGGCSADIKYGIDFSRKFVDAREIKKNARRLMNLHNNEAGRKVLE 126

  Fly   190 KMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLR--LVLSRKKH 252
            :.::.:||||||||||..||||.:||.||.:|..|..||..|..|:.|:..| ||  ..|..|| 
 Frog   127 EKMKLECKCHGVSGSCTTKTCWNTLPKFREIGFVLKEKYNDAVHVEVVRANR-LRQPTFLKIKK- 189

  Fly   253 AGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHN 317
              ....|||:     ..:|:|:|.||||||....|||.||.||.|.||......|||:|||||:|
 Frog   190 --VRSYQKPM-----ETDLVYIERSPNYCEEDSATGSVGTQGRLCNRTSPHTDGCDLMCCGRGYN 247

  Fly   318 TQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |....:..||.|:|.|||.|||:.|.|..|.||||
 Frog   248 THQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 148/293 (51%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 148/293 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 347 1.000 Domainoid score I1033
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 1 1.000 - - FOG0002358
OrthoInspector 1 1.000 - - otm47695
Panther 1 1.100 - - LDO PTHR12027
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.