DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt3

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001096552.1 Gene:wnt3 / 100125198 XenbaseID:XB-GENE-479567 Length:354 Species:Xenopus tropicalis


Alignment Length:362 Identity:161/362 - (44%)
Similarity:212/362 - (58%) Gaps:31/362 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIYILWIM-------------EIRLVSSFTSV----MLCGRIPGLTPGQRNMCREMPDALIALGE 56
            |::.|||.             .:.|...::::    :|||.||||.|.|...||...:.:.::.|
 Frog     6 LLHFLWIFSAAPVLAGYPIWWSLALGQQYSTLGSQPILCGSIPGLVPKQMRFCRNYIEIMPSVAE 70

  Fly    57 GHQLGAQECQHQFRGHRWNCSEVWQR-NVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNI 120
            |.:||.|||||||||.||||:.:... .:|..|:..|:||:|:.:||||||.|:|||.:||.|:.
 Frog    71 GIKLGIQECQHQFRGRRWNCTTIHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSS 135

  Fly   121 STCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGR 185
            :.||||..||      |:|.:.|||||||.|.|||:..:|.|.||||...|:|:.||.|||.|||
 Frog   136 TICGCDSHHK------GSPGDGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNRHNNEAGR 194

  Fly   186 TLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRK 250
            ..:...:...|||||:||||.:||||.|.|.||.:||.|..||..|..:...|.:..       :
 Frog   195 ATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDKYDSASEMSVEKHRES-------R 252

  Fly   251 KHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRG 315
            ....|.||:..:...|...:|:|.|.|||:||.:.:|||.||.||:|..|.||...|||||||||
 Frog   253 GWVETLRAKYSLFKPPTERDLVYYETSPNFCEPNPETGSFGTQGRSCNVTSHGIDGCDLLCCGRG 317

  Fly   316 HNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352
            |||:..:|..:|.|.|.|||.|.|.||...|:..|||
 Frog   318 HNTRTEKRKEKCHCIFHWCCYVSCQECVRIYDVHTCK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 148/316 (47%)
wnt3NP_001096552.1 Wnt_Wnt3_Wnt3a 41..354 CDD:381709 154/325 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.