DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt2 and wnt16

DIOPT Version :9

Sequence 1:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001096551.1 Gene:wnt16 / 100125197 XenbaseID:XB-GENE-484267 Length:376 Species:Xenopus tropicalis


Alignment Length:348 Identity:135/348 - (38%)
Similarity:196/348 - (56%) Gaps:42/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSE---------------- 78
            |..:| |:..|:.|||:.|..|.::.||.:||..||::||:..|||||.                
 Frog    46 CTNLP-LSFHQKEMCRKKPYLLSSIREGARLGIHECRNQFKHERWNCSVSPTISSASSSFSLSFI 109

  Fly    79 ----VWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTP 139
                .....:|.:.:.:.::|.|:..|:.:||..::||.||:.||::.|.||    .:...||:.
 Frog   110 TSSLASAHTIFGYELSSGTKETAFISAVTAAGLVHSVTRACSAGNMTECSCD----TSLQNGGSA 170

  Fly   140 DEPWKWGGCSADVDFGMRYARRFMDA---RELERDSRTL--MNLHNNRAGRTLVKKMLRTDCKCH 199
            .|.|.|||||.|:.:||.::|:|:||   ....|||..|  |:||||.|||..|.|::..||:||
 Frog   171 SEGWHWGGCSDDLQYGMWFSRKFLDAPYKNSSGRDSDVLNAMHLHNNEAGRQAVTKLMTVDCRCH 235

  Fly   200 GVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLD 264
            ||||||.:||||||:..|..:|:.|..||:.:..: |.:.||.:|   .|:|:    ..:.|:. 
 Frog   236 GVSGSCAVKTCWKSMSSFEKIGNFLKNKYENSIQI-ADRLKRKVR---RREKN----DRKIPIY- 291

  Fly   265 WPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRC 329
               :.:|:|...|||||....:.|..||.||.|.||..|..||:|||||||:||..:|...:|.|
 Frog   292 ---KGDLVYTNKSPNYCVEDPKLGISGTHGRECNRTSEGSDSCNLLCCGRGYNTHVVRHVERCEC 353

  Fly   330 QFRWCCEVKCDECDESYEEFTCK 352
            :|.|||.|:|..|:...:..|||
 Frog   354 KFVWCCYVRCRRCESMTDVHTCK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt2NP_476810.1 wnt 36..352 CDD:278536 131/340 (39%)
wnt16NP_001096551.1 Wnt_Wnt16 51..376 CDD:381718 131/340 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3295
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.