DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camta and LOC110439124

DIOPT Version :9

Sequence 1:NP_001137624.1 Gene:Camta / 35974 FlyBaseID:FBgn0287478 Length:2044 Species:Drosophila melanogaster
Sequence 2:XP_021329395.1 Gene:LOC110439124 / 110439124 -ID:- Length:188 Species:Danio rerio


Alignment Length:126 Identity:73/126 - (57%)
Similarity:91/126 - (72%) Gaps:3/126 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 NAVTSEQQQQQQQQSTTTQTNVPLGNDGEPIKLPDN-LESLPRADSFPSQRHRWNTNEEIAAILI 440
            :||........:..|..|:||...|:  ..|.||.. ||.||:..:.|.:||||||||||||.||
Zfish    22 SAVCYSAHAPPKSVSDDTETNNEHGH--LKIYLPKKLLECLPKCSTLPKERHRWNTNEEIAAYLI 84

  Fly   441 SFDKHGEWQSKEVRTRPKSGSLLLYSRKKVRYRRDGYCWKKRKDGKTTREDHMKLKVQGTE 501
            :|:||.||.:...:|||::||::||:||||:||:|||||||||||||||||||||||||.|
Zfish    85 TFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKLKVQGVE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamtaNP_001137624.1 CG-1 422..538 CDD:198144 59/80 (74%)
TIG 1242..1319 CDD:280079
ANK <1405..1497 CDD:238125
ANK repeat 1405..1447 CDD:293786
Ank_2 1410..1500 CDD:289560
ANK repeat 1449..1481 CDD:293786
LOC110439124XP_021329395.1 CG-1 66..>146 CDD:322608 59/80 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D161424at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.