DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and ldlrap1b

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001074104.1 Gene:ldlrap1b / 791153 ZFINID:ZDB-GENE-070112-1012 Length:304 Species:Danio rerio


Alignment Length:292 Identity:69/292 - (23%)
Similarity:127/292 - (43%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AKSEAKNGK-----RNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKK 139
            ||....:||     .||..|.|.|:.| .|:.:|:.|...|::|||.|:...|::::     :..
Zfish    18 AKQSWISGKHKKLPENWTDTRETLLEG-MVFQLKYLGMTLVEEPKGEELSAAAVKRI-----VAT 76

  Fly   140 AETGTQEKFKKLEITISIKGVAIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDG 204
            |:.| .:|.:|:.:.:|.:|:.:.:..:::::....:|.||||..:|...|.|::||::.:    
Zfish    77 AKAG-GKKLQKVTLKVSPRGIILYDSASNQLIENVSIYRISYCTADKMHDKVFAYIAQSQR---- 136

  Fly   205 SDPTSNGHANGNGDGSAKVEESHECFVFI--SNKLASDITLTIGQAFDLAYRKYMDSTEKTNLSK 267
                               .|:.||..::  ..|:|..:|||:.|||.:|:..:..:.|     :
Zfish   137 -------------------NETLECHAYLCTKRKVAQAVTLTVAQAFRVAFEFWQTAKE-----E 177

  Fly   268 AQQQINHLQQTVNVYKERLREVSAKLP--KAEL---DALLFNLGIKD--------ILEAPTTEPQ 319
            .::|:. .............|.||.|.  |.|:   |.|....|:||        .::..:||..
Zfish   178 KEKQVK-CGSDGEAASSSQSESSASLSSMKGEVATGDLLDLECGVKDRSGKDAAHPVQNHSTENN 241

  Fly   320 N-------GIEVASEALSNGKLDDDKLLIDTN 344
            |       |::.|...|:....:...|.|..|
Zfish   242 NTVWELEDGLDEAFSRLAESCTNPQVLDIGVN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 41/170 (24%)
AceK 233..>304 CDD:295079 19/77 (25%)
ldlrap1bNP_001074104.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.