DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and Anks1b

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_030101220.1 Gene:Anks1b / 77531 MGIID:1924781 Length:1339 Species:Mus musculus


Alignment Length:236 Identity:59/236 - (25%)
Similarity:96/236 - (40%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKAAAKMAQ----LKFWNKQNSSKQQQQDKDKDAADGGNNTSGGGTGS-NSNGDAKSEAKNGKRN 90
            ||...:|||    .:.|..||:.      ....|....:||...|..| ......::.|....:.
Mouse  1043 SKLERQMAQQSSVCEIWTNQNAG------FPFSAIHQVHNTGDWGEPSITLRPPNEATASTPVQY 1101

  Fly    91 WLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKL-----QFAQQMKKAETGTQEKFKK 150
            |.|.||:||.....|...:.|::.:.:.:|.|..::|..|:     :..:||||..|        
Mouse  1102 WQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPT-------- 1158

  Fly   151 LEITISIKGVAIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANG 215
            :.:::|.|||...:.....|:.:..:.|||..|.:......|::|.|.:|:              
Mouse  1159 IILSVSYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKS-------------- 1209

  Fly   216 NGDGSAKVEESHECFVF--ISNKLASDITLTIGQAFDLAYR 254
                     ..|.|.||  ....||.:|.||:||||::||:
Mouse  1210 ---------NHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQ 1241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 44/170 (26%)
AceK 233..>304 CDD:295079 11/22 (50%)
Anks1bXP_030101220.1 PHA02874 7..385 CDD:165205
ANK repeat 7..56 CDD:293786
ANK repeat 58..89 CDD:293786
Ank_2 63..158 CDD:372319
ANK repeat 91..125 CDD:293786
ANK repeat 127..158 CDD:293786
ANK repeat 160..191 CDD:293786
Ank_2 165..256 CDD:372319
ANK repeat 193..223 CDD:293786
ANK repeat 226..256 CDD:293786
Retinal <480..>629 CDD:373855
SAM_AIDA1AB-like_repeat1 840..906 CDD:188898
SAM_AIDA1AB-like_repeat2 911..975 CDD:188899
PTB_Anks 1100..1249 CDD:269972 45/173 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.