DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and appl1

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_021335332.1 Gene:appl1 / 571540 ZFINID:ZDB-GENE-081016-1 Length:708 Species:Danio rerio


Alignment Length:295 Identity:60/295 - (20%)
Similarity:121/295 - (41%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQQQDKDKDAADGGNNTSGGGTGSNSNGDAKSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSV 115
            ::...:.|.:|.|......|.:|.:.:.:::....                |.:::|:|.|::.|
Zfish   462 EEHTSQTKSSAQGRRTNPFGESGGSQSEESEDSIL----------------HQLFIVRFLGSMEV 510

  Fly   116 DQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQEPRTHKILHQFPLYNIS 180
            ...:..:|:.|.:|::..|:.:......|:.     .:.::.:.:.:.:|:|.....:|||.::.
Zfish   511 KATESSDVIYETMRQILAARAIHNIFRMTES-----HLLVTCECLKLIDPQTQVTRLRFPLSSVV 570

  Fly   181 YCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASDITLTI 245
            .||..:..|:.|.|:.:|              |.|..||    :....|::|.||.....|..:|
Zfish   571 LCASHQENKRLFGFVLQT--------------AGGRADG----QPVTVCYIFESNNDGEKICDSI 617

  Fly   246 GQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALLFNLGIKDI 310
            |.|..:|....||       .||.|:    |:.::..||:.:|...|..:.|          ||:
Zfish   618 GLAKQIALHSEMD-------RKASQK----QRELDKAKEKQQEELHKQKQIE----------KDL 661

  Fly   311 LEAPTTEPQNGIEVASEALSNGKLDDDKLLIDTNS 345
                  |.|:.: :|:.:..|....|.:.|:.:||
Zfish   662 ------EEQSRL-IAASSRPNQPAADGQFLVLSNS 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 36/168 (21%)
AceK 233..>304 CDD:295079 18/70 (26%)
appl1XP_021335332.1 BAR_APPL1 20..234 CDD:153315
BAR-PH_APPL 252..376 CDD:270067
PTB_APPL 488..623 CDD:269980 33/173 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.