DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and APPL2

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:313 Identity:55/313 - (17%)
Similarity:108/313 - (34%) Gaps:94/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKTAPTTTMPYQPANSGGTSGGSKAAAKMAQLKFWNKQNSSKQQQQDK------------DKDAA 61
            :|...|......|..|.|....|...::       |.:||..:.:.||            ::..|
Human   394 IKLNQTALQAVTPITSFGKKQESSCPSQ-------NLKNSEMENENDKIVPKATASLPEAEELIA 451

  Fly    62 DGGN-------------NTSGGGTGSNSNGDAKSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNL 113
            .|..             :.:.|...:|..|:.:.|      ::....:.|:  ..:::|:|.|::
Human   452 PGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDE------SFPEAEDSLL--QQMFIVRFLGSM 508

  Fly   114 SVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQEPRTHKILHQFPLYN 178
            :|......||:.||:|::..|:.:......|:.     .:.::.:.:.:.:|:|......|.|.:
Human   509 AVKTDSTTEVIYEAMRQVLAARAIHNIFRMTES-----HLMVTSQSLRLIDPQTQVSRANFELTS 568

  Fly   179 ISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASDITL 243
            ::..|..:..|:...|:.:.        |.|.|            |||...::|.||.....|..
Human   569 VTQFAAHQENKRLVGFVIRV--------PESTG------------EESLSTYIFESNSEGEKICY 613

  Fly   244 TIGQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYK--ERLREVSAKLP 294
            .|                  ||.|         :.:.|.|  |.|.::...:|
Human   614 AI------------------NLGK---------EIIEVQKDPEALAQLMLSIP 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 30/168 (18%)
AceK 233..>304 CDD:295079 12/64 (19%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316
BAR-PH_APPL 258..382 CDD:270067
PTB_APPL 488..621 CDD:269980 33/186 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.