DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and Aplip1

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:81/216 - (37%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GDAKSEAKNGKRNW-----LHTPEQLI--SGHAV------------------YLVKFFGNLSVDQ 117
            |||....|..:..|     |.|..|.|  |.:||                  ||:.:.|::....
  Fly   295 GDAIYVQKEAEDLWCEGVNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLA 359

  Fly   118 PKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQE---PRTHK------ILHQ 173
            .||..||.:|:||:       ..|.|.....:...:.:|.:|:.:.:   |..:|      |.:.
  Fly   360 HKGTGVVCQAVRKI-------VGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCIDYF 417

  Fly   174 FPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLA 238
            :.|.|:|:||......:|..||.|        .||....|               |.||..::..
  Fly   418 YSLKNVSFCAFHPRDHRFIGFITK--------HPTVQRFA---------------CHVFKGSEST 459

  Fly   239 SDITLTIGQAFDLAYRKYMDS 259
            ..:...:|:||...|:|::::
  Fly   460 RPVAEAVGRAFQRFYQKFIET 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 44/197 (22%)
AceK 233..>304 CDD:295079 5/27 (19%)
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 11/33 (33%)
PTB_JIP 343..490 CDD:269923 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.