DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and CG14968

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:159 Identity:34/159 - (21%)
Similarity:61/159 - (38%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 YLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQ--EPRT 167
            :.||:.|:   :..:|:..:|...|.:.....:.| .....:.....|:.:|..||.::  .|:.
  Fly    24 FKVKYIGS---EVARGLWGIKYTRRPVDIMVGVAK-NLPPNKVLPNCELKVSTDGVQLEIISPKA 84

  Fly   168 HKILH-QFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFV 231
             .|.| .:|:..|||...:....:.|:.|  .||.:....|.                |.| .||
  Fly    85 -SINHWSYPIDTISYGVQDLVYTRVFAMI--VVKDESSPHPF----------------EVH-AFV 129

  Fly   232 FISNKLASDITLTIGQAFDLAYRKYMDST 260
            ..|..:|..:|..:..||....|:..::|
  Fly   130 CDSRAMARKLTFALAAAFQDYSRRVKEAT 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 34/159 (21%)
AceK 233..>304 CDD:295079 7/28 (25%)
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.