DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and ldlrap1a

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_945331.1 Gene:ldlrap1a / 368278 ZFINID:ZDB-GENE-030328-13 Length:287 Species:Danio rerio


Alignment Length:305 Identity:70/305 - (22%)
Similarity:132/305 - (43%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SEAKNGK--RNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGT 144
            |..|:.|  .||..|.|.|:.| ..:.::..|...||||||.|:...|::::....:      .:
Zfish    23 SSGKHKKLPENWTDTRETLLEG-MTFNLRHLGMTLVDQPKGEELSAAAVKRIVATAK------AS 80

  Fly   145 QEKFKKLEITISIKGVAIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTS 209
            .:|..|:.:.:|.:|:.:.:..:::::....:|.||||..:|...|.|:|||:.           
Zfish    81 GKKLPKVALKVSPQGIILYDSVSNQLIENISIYRISYCTADKTHDKVFAFIAQN----------- 134

  Fly   210 NGHANGNGDGSAKVEESHECFVFI--SNKLASDITLTIGQAFDLAY---------RKYMDSTEKT 263
                        :..|:.||..|:  ..|:|..:|||:.|||.:|:         :|:..:.|.:
Zfish   135 ------------QQNETLECHAFLCAKRKVAKAVTLTVAQAFRVAFEFWEVAKDEKKWDSAGETS 187

  Fly   264 NLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALL----FNLGIKDILEAPTTEPQN---- 320
            |.|::.:.::              ..|.|:..|..:.||    :...::|: :.| .||.|    
Zfish   188 NSSQSDRSVS--------------LTSLKVGAAATENLLEIEDYTSALEDV-DNP-IEPNNNNTT 236

  Fly   321 ------GIEVASEALSNGKLDDDKLLIDTNSTTA--STHSASPSS 357
                  |:|.|...|:..:.:...|.|..:|.:.  .|:..||::
Zfish   237 LWEMDDGLEEAFSRLAESRTNPQVLDIGLSSESEWDETNGNSPNA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 42/179 (23%)
AceK 233..>304 CDD:295079 18/85 (21%)
ldlrap1aNP_945331.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.