DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and Appl2

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:172 Identity:35/172 - (20%)
Similarity:69/172 - (40%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQEPRTH 168
            :::|:|.|:::|......||:.||:|::..|:.:......|:.     .:.::.:.:.:.:|:|.
  Rat   491 MFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRTTES-----HLMVTSQTLRLIDPQTQ 550

  Fly   169 KILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFI 233
            .....|.|.:::..|..:..|:...|:.:.        |.|.|            |||...::|.
  Rat   551 VSRACFELTSVTQFAAHQENKRLVGFVIRV--------PESTG------------EESLSTYIFE 595

  Fly   234 SNKLASDITLTIGQAFDL--------AYRKYMDSTEKTNLSK 267
            ||.....|...|....::        |..:.|.|...||..|
  Rat   596 SNSEGEKICYAINLGKEIIEVQKDPEALARLMLSVPLTNDGK 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 32/164 (20%)
AceK 233..>304 CDD:295079 10/43 (23%)
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316
BAR-PH_APPL 252..376 CDD:270067
PTB_APPL 480..613 CDD:269980 29/146 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.