DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and APPL1

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:104/248 - (41%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQQQDKDKDAADGGNNTSGGGTGSNSNGDAKSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSV 115
            :.|..:.|....||..|:..|   .|.|..|||          |.:.::  |.:::|:|.|::.|
Human   463 EDQPGQAKAFGQGGRRTNPFG---ESGGSTKSE----------TEDSIL--HQLFIVRFLGSMEV 512

  Fly   116 DQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGVAIQEPRTHKILHQFPLYNIS 180
            ......:||.|.:|::..|:.:......|:.     .:.::...:.:.:|:|......|||..:.
Human   513 KSDDHPDVVYETMRQILAARAIHNIFRMTES-----HLLVTCDCLKLIDPQTQVTRLTFPLPCVV 572

  Fly   181 YCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASDITLTI 245
            ..|..:..|:.|.|:.:          ||:|.:..|        .|..|::|.||.....|..::
Human   573 LYATHQENKRLFGFVLR----------TSSGRSESN--------LSSVCYIFESNNEGEKICDSV 619

  Fly   246 GQAFDLAYRKYMD--STEKTN-----LSKAQQQINHLQQTVNVYKERLREVSA 291
            |.|..:|....:|  ::||..     ..|.|:::|..:|.....:|:.|.::|
Human   620 GLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAA 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 35/170 (21%)
AceK 233..>304 CDD:295079 16/66 (24%)
APPL1NP_036228.1 Required for RAB5A binding 1..428
BAR_APPL1 20..234 CDD:153315
BAR-PH_APPL 252..376 CDD:270067
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434
F&H 403..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491 7/26 (27%)
PTB_APPL 490..625 CDD:269980 36/169 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.