DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-6 and appl2

DIOPT Version :9

Sequence 1:NP_001246225.1 Gene:ced-6 / 35971 FlyBaseID:FBgn0029092 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001121547.1 Gene:appl2 / 100000135 ZFINID:ZDB-GENE-081016-2 Length:662 Species:Danio rerio


Alignment Length:229 Identity:50/229 - (21%)
Similarity:82/229 - (35%) Gaps:49/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GSNSNGDAKSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQM 137
            |.....|.:|:          |.:.|:  ..|:.|:|.|:::|......||:.||:|::..|:.:
Zfish   473 GETEEDDDESD----------THDSLL--QQVFAVRFLGSMAVRSGHTQEVIYEAMRQVLAARAI 525

  Fly   138 KKAETGTQEKFKKLE--ITISIKGVAIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVK 200
            ...       ||..|  :.||...:.:.:|:|......|.|..:|..|..:..::...|:.::..
Zfish   526 HNI-------FKTTESHLMISSSCIRLIDPQTQVTKISFQLQEVSEFAAHQENERLMGFVVRSSA 583

  Fly   201 TQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASDITLTIGQAFDL--------AYRKYM 257
            ..|                    |.|...|||.||.....|..||..|.::        |..:.|
Zfish   584 EDD--------------------EPSFSVFVFESNTEGEKICYTINLAKEIADARKDPEALAQLM 628

  Fly   258 DSTEKTNLSKAQQQINHLQQTVNVYKERLREVSA 291
            .|...||..|.....|....|.....:..:|..|
Zfish   629 KSMPLTNDGKFLLLDNETGDTAETAGQEQQESEA 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-6NP_001246225.1 PTB_CED-6 92..261 CDD:269971 40/178 (22%)
AceK 233..>304 CDD:295079 16/67 (24%)
appl2NP_001121547.1 BAR 21..235 CDD:299863
BAR-PH_APPL 253..375 CDD:270067
PH 277..377 CDD:278594
PTB_APPL 488..614 CDD:269980 36/154 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.